PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00051639001
Common NameGSBRNA2T00051639001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 473aa    MW: 51564.8 Da    PI: 6.5707
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00051639001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.57.2e-2969122155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kpr++W+ eLH++Fv av+qL G +kA+Pk+ile+m+v+gLt+e+v+SHLQkYR+
  GSBRNA2T00051639001  69 KPRVVWSVELHQQFVAAVNQL-GVDKAVPKKILEMMNVPGLTRENVASHLQKYRI 122
                          79*******************.********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.32366125IPR017930Myb domain
SuperFamilySSF466894.48E-2067126IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.8E-3068127IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-2469122IPR006447Myb domain, plants
PfamPF002496.6E-971121IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
QHVVRKKRNE WNVSEHSGSV EETGQREDGD NNSSSANNEG SWRGSRKRKE EEVDEQGGDD  60
KEDTSSLKKP RVVWSVELHQ QFVAAVNQLG VDKAVPKKIL EMMNVPGLTR ENVASHLQKY  120
RIYLRRLGGV SQHQGNMNHS FMTGQDPSFG PLSTLNGFDL QALAAAGQLP AQSLAHLQAA  180
GLARPPSLTK PGMSVDQRSI FSFENPKIRH GQMMNSGGGG NKQMNLLHGQ QQLSGGRAVG  240
QNVQSSGMMM PVGGGPSMLQ QQQQVMLSSS VPRRSETSSS SRVLPAAATT QSVVFNNFSS  300
ELPRNSFPLA SAPGISVSYQ EEVNSSDAKG GAGFGNPSYD IFNDYPQQHN NNNDWDLQNI  360
GMVFNSHQDT TTASAAFSSS SSTQRQRAEH VQNHHQQQQL PSQSLNHMNG GGSVRVKSER  420
VAETVTCPPA TTLFQEQYNQ EDLMSALLKQ EGLPLVDNEF DFDGYSFDNI PV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A2e-2265127163ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.216301e-130leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00051639001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1896324e-40AC189632.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrS003O10, complete sequence.
GenBankAC2324694e-40AC232469.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB026A07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013601580.10.0PREDICTED: two-component response regulator ARR2-like
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLA0A078H4830.0A0A078H483_BRANA; BnaA01g17750D protein (Fragment)
STRINGBra033527.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24032773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.10.0response regulator 2
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]